PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G20660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 817aa    MW: 87019.2 Da    PI: 5.6207
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G20660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.91.5e-22122177156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
  ONIVA04G20660.1 122 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMK 177
                      688999***********************************************998 PP

2START161.85.2e-513335672206
                      HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S.... CS
            START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla.... 77 
                      la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d  ++W+ ++     
  ONIVA04G20660.1 333 LAMSAMDELVKMAQMGDPLWIPGAsvpsspakESLNFEEYLNTFPPCIGvkpegYVSEASRESGIVIIDdGAALVETLMDEVRRWSDMFScmia 426
                      67899***************9766667999****************9999**************998651568********************* PP

                      EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECT CS
            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksn 159
                      ka+t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg+++++++n
  ONIVA04G20660.1 427 KASTTEEISTGvagsrnGALLLMQAELQVLSPLVPiREVKFLRFSKQLADGVWAVVDVSADELMRDQGitsasSTANMNCRRLPSGCVLQDTPN 520
                      ************************************************************9987666666454555689*************** PP

                      CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      g  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
  ONIVA04G20660.1 521 GFVKVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWIATLQRQCEC 567
                      *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-22106177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-24108179IPR009057Homeodomain-like
PROSITE profilePS5007118.366119179IPR001356Homeobox domain
SMARTSM003893.2E-20120183IPR001356Homeobox domain
CDDcd000861.14E-20121177No hitNo description
PfamPF000467.6E-20122177IPR001356Homeobox domain
PRINTSPR000318.8E-5150159IPR000047Helix-turn-helix motif
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
PRINTSPR000318.8E-5159175IPR000047Helix-turn-helix motif
PROSITE profilePS5084842.319323570IPR002913START domain
SuperFamilySSF559612.47E-23326567No hitNo description
CDDcd088751.45E-104327566No hitNo description
SMARTSM002342.8E-40332567IPR002913START domain
PfamPF018521.3E-42333567IPR002913START domain
SuperFamilySSF559611.11E-15587782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MSFGVGDHFG DGVVPAGMQF PFSGAGPGVF TSSPALSLAL ADAVAGRNSG GGGKMVTAAH  60
GGVGGGGGGG RAKARDALEV ENEMSRSGSD HLDVVSCGDA GGGGGDDDDD EDAEHGNPPK  120
RKKRYHRHTP QQIQELEAMF KECPHPDEKQ RAELSKRLGL EPRQVKFWFQ NRRTQMKMQL  180
ERHENSLLKQ ENDKLRSENL SIREATSNAV CVGCGGPAML GEVSLEEHHL RVENARLKDE  240
LSRVCALAAK FLGKSISVMA PPQMHQPHPV PGSSLELAVG GIGSMPSATM PISTITDFAG  300
AMSSSMGTVI TPMKSEAEPS AMAGIDKSLF LELAMSAMDE LVKMAQMGDP LWIPGASVPS  360
SPAKESLNFE EYLNTFPPCI GVKPEGYVSE ASRESGIVII DDGAALVETL MDEVRRWSDM  420
FSCMIAKAST TEEISTGVAG SRNGALLLMQ AELQVLSPLV PIREVKFLRF SKQLADGVWA  480
VVDVSADELM RDQGITSASS TANMNCRRLP SGCVLQDTPN GFVKVTWVEH TEYDEASVHP  540
LYRPLLRSGL ALGAGRWIAT LQRQCECLAL LMSSIALPEN DSSAIHPEGK RSMLKLARRM  600
TDNFCAGVST SSTREWSKLV GLTGNIGEDV HVMARKSVDE PGTPPGVVLS AATSVWMPVM  660
PERLFNFLHN KGLRAEWDIL SNGGPMQEVT SIAKGQQNGN TPTKDKQNSM LILQETCADA  720
SGSMVVYAPV DIPAMHLVMS GGDSSCVALL PSGFAILPAG PSIGADHKMG GSLLTVAFQI  780
LANSQPSAKL TVESVETVSN LISCTIKKIK TALHCDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0E0H4K30.0A0A0E0H4K3_ORYNI; Uncharacterized protein
STRINGBGIOSGA014527-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein